![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.62: Integrin A (or I) domain [53299] (1 superfamily) |
![]() | Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins) |
![]() | Protein von Willebrand factor A3 domain [53304] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53305] (3 PDB entries) |
![]() | Domain d1fe8b_: 1fe8 B: [59784] Other proteins in same PDB: d1fe8h1, d1fe8h2, d1fe8i1, d1fe8i2, d1fe8j1, d1fe8j2, d1fe8l1, d1fe8l2, d1fe8m1, d1fe8m2, d1fe8n1, d1fe8n2 |
PDB Entry: 1fe8 (more details), 2.03 Å
SCOP Domain Sequences for d1fe8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe8b_ c.62.1.1 (B:) von Willebrand factor A3 domain {Human (Homo sapiens)} pdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidv pwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdv svdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtl gnsflhklcs
Timeline for d1fe8b_: