Lineage for d1fe8b_ (1fe8 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72868Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 72869Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 72870Family c.62.1.1: Integrin A (or I) domain [53301] (6 proteins)
  6. 72910Protein von Willebrand factor A3 domain [53304] (1 species)
  7. 72911Species Human (Homo sapiens) [TaxId:9606] [53305] (3 PDB entries)
  8. 72917Domain d1fe8b_: 1fe8 B: [59784]
    Other proteins in same PDB: d1fe8h1, d1fe8h2, d1fe8i1, d1fe8i2, d1fe8j1, d1fe8j2, d1fe8l1, d1fe8l2, d1fe8m1, d1fe8m2, d1fe8n1, d1fe8n2

Details for d1fe8b_

PDB Entry: 1fe8 (more details), 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding

SCOP Domain Sequences for d1fe8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe8b_ c.62.1.1 (B:) von Willebrand factor A3 domain {Human (Homo sapiens)}
pdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidv
pwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdv
svdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtl
gnsflhklcs

SCOP Domain Coordinates for d1fe8b_:

Click to download the PDB-style file with coordinates for d1fe8b_.
(The format of our PDB-style files is described here.)

Timeline for d1fe8b_: