SCOPe 2.08: Domain d1fdqb_: 1fdq B:

Lineage for d1fdqb_ (1fdq B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Brain fatty acid binding protein [63809] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63810] (3 PDB entries)

8. Domain d1fdqb_: 1fdq B: [59777]
   complexed with hxa

Details for d1fdqb_

PDB Entry: 1fdq, 2.1 Å

PDB Description: crystal structure of human brain fatty acid binding protein

PDB Compounds: (B:) fatty acid-binding protein, brain

SCOPe Domain Sequences for d1fdqb_:

Sequence; same for both SEQRES and ATOM records:

>d1fdqb_ b.60.1.2 (B:) Brain fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
veafcatwkltnsqnfdeymkalgvgfatrqvgnvtkptviisqegdkvvirtlstfknt
eisfqlgeefdettaddrncksvvsldgdklvhiqkwdgketnfvreikdgkmvmtltfg
dvvavrhyeka

Timeline for d1fdqb_:

• d1fdqb_ first appeared in SCOP 1.57
  
• d1fdqb_ appears in SCOPe 2.07