SCOPe 2.07: Domain d1fcla_: 1fcl A:

Lineage for d1fcla_ (1fcl A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)

8. Domain d1fcla_: 1fcl A: [59768]
   computationally designed core variant Delta1.5

Details for d1fcla_

PDB Entry: 1fcl

PDB Description: delta1.5: a computationally designed core variant of the b1 domain of streptococcal protein g

PDB Compounds: (A:) immunoglobulin g binding protein g

SCOPe Domain Sequences for d1fcla_:

Sequence; same for both SEQRES and ATOM records:

>d1fcla_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
ttfkliingktlkgettteavdaataekvlkqyindngidgewtyddatktwtvte

Timeline for d1fcla_:

• d1fcla_ first appeared in SCOP 1.57
  
• d1fcla_ appears in SCOPe 2.06
  
• d1fcla_ appears in the current release, SCOPe 2.08