![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
![]() | Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) ![]() automatically mapped to Pfam PF03453 |
![]() | Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
![]() | Domain d1fc5b2: 1fc5 B:6-177 [59766] Other proteins in same PDB: d1fc5a1, d1fc5a3, d1fc5b1, d1fc5b3 complexed with mg |
PDB Entry: 1fc5 (more details), 2.2 Å
SCOPe Domain Sequences for d1fc5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fc5b2 b.103.1.1 (B:6-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} glmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrl adiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvr ftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d1fc5b2: