Lineage for d1fc5b2 (1fc5 B:6-177)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811992Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 811993Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 811994Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 812002Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 812005Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 812011Domain d1fc5b2: 1fc5 B:6-177 [59766]
    Other proteins in same PDB: d1fc5a1, d1fc5a3, d1fc5b1, d1fc5b3
    complexed with mo6

Details for d1fc5b2

PDB Entry: 1fc5 (more details), 2.2 Å

PDB Description: crystal structure of molybdopterin biosynthesis moea protein
PDB Compounds: (B:) molybdopterin biosynthesis moea protein

SCOP Domain Sequences for d1fc5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc5b2 b.103.1.1 (B:6-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
glmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrl
adiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvr
ftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOP Domain Coordinates for d1fc5b2:

Click to download the PDB-style file with coordinates for d1fc5b2.
(The format of our PDB-style files is described here.)

Timeline for d1fc5b2: