Lineage for d1fc5a3 (1fc5 A:178-326)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489418Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 489419Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 489464Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
  6. 489469Protein MoeA, central domain [64104] (2 species)
  7. 489472Species Escherichia coli [TaxId:562] [64105] (3 PDB entries)
  8. 489475Domain d1fc5a3: 1fc5 A:178-326 [59764]
    Other proteins in same PDB: d1fc5a1, d1fc5a2, d1fc5b1, d1fc5b2

Details for d1fc5a3

PDB Entry: 1fc5 (more details), 2.2 Å

PDB Description: crystal structure of molybdopterin biosynthesis moea protein

SCOP Domain Sequences for d1fc5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc5a3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

SCOP Domain Coordinates for d1fc5a3:

Click to download the PDB-style file with coordinates for d1fc5a3.
(The format of our PDB-style files is described here.)

Timeline for d1fc5a3: