SCOPe 2.02: Domain d1fc5a1: 1fc5 A:327-408

Lineage for d1fc5a1 (1fc5 A:327-408)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family)

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)

7. Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)

8. Domain d1fc5a1: 1fc5 A:327-408 [59762]
   Other proteins in same PDB: d1fc5a2, d1fc5a3, d1fc5b2, d1fc5b3
   complexed with mg

Details for d1fc5a1

PDB Entry: 1fc5, 2.2 Å

PDB Description: crystal structure of molybdopterin biosynthesis moea protein

PDB Compounds: (A:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1fc5a1:

Sequence; same for both SEQRES and ATOM records:

>d1fc5a1 b.85.6.1 (A:327-408) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalf

Timeline for d1fc5a1:

• d1fc5a1 first appeared in SCOP 1.57
  
• d1fc5a1 appears in SCOPe 2.01
  
• d1fc5a1 appears in SCOPe 2.03
  
• d1fc5a1 appears in the current release, SCOPe 2.08