Lineage for d1fc5a1 (1fc5 A:327-408)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568126Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 568335Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) (S)
  5. 568336Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 568341Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 568344Species Escherichia coli [TaxId:562] [63870] (3 PDB entries)
  8. 568347Domain d1fc5a1: 1fc5 A:327-408 [59762]
    Other proteins in same PDB: d1fc5a2, d1fc5a3, d1fc5b2, d1fc5b3

Details for d1fc5a1

PDB Entry: 1fc5 (more details), 2.2 Å

PDB Description: crystal structure of molybdopterin biosynthesis moea protein

SCOP Domain Sequences for d1fc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc5a1 b.85.6.1 (A:327-408) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalf

SCOP Domain Coordinates for d1fc5a1:

Click to download the PDB-style file with coordinates for d1fc5a1.
(The format of our PDB-style files is described here.)

Timeline for d1fc5a1: