Lineage for d1fc4b1 (1fc4 B:1-398)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131703Protein 2-amino-3-ketobutyrate CoA ligase [64128] (1 species)
  7. 2131704Species Escherichia coli [TaxId:562] [64129] (1 PDB entry)
  8. 2131706Domain d1fc4b1: 1fc4 B:1-398 [59761]
    Other proteins in same PDB: d1fc4a2, d1fc4b2
    complexed with akb

Details for d1fc4b1

PDB Entry: 1fc4 (more details), 2 Å

PDB Description: 2-amino-3-ketobutyrate coa ligase
PDB Compounds: (B:) 2-amino-3-ketobutyrate conenzyme a ligase

SCOPe Domain Sequences for d1fc4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc4b1 c.67.1.4 (B:1-398) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]}
mrgefyqqltndletaraeglfkeeriitsaqqaditvadgshvinfcannylglanhpd
liaaakagmdshgfgmasvrficgtqdshkeleqklaaflgmedailysscfdangglfe
tllgaedaiisdalnhasiidgvrlckakryryanndmqelearlkeareagarhvliat
dgvfsmdgvianlkgvcdladkydalvmvddshavgfvgengrgsheycdvmgrvdiitg
tlgkalggasggytaarkevvewlrqrsrpylfsnslapaivaasikvlemveagselrd
rlwanarqfreqmsaagftlagadhaiipvmlgdavvaqkfarelqkegiyvtgffypvv
pkgqarirtqmsaahtpeqitraveaftrigkqlgvia

SCOPe Domain Coordinates for d1fc4b1:

Click to download the PDB-style file with coordinates for d1fc4b1.
(The format of our PDB-style files is described here.)

Timeline for d1fc4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc4b2