Lineage for d1fb2b_ (1fb2 B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286043Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulphide-linked, and a calcium-binding loop
  4. 286044Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 286049Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 286123Protein Snake phospholipase A2 [48624] (27 species)
  7. 286221Species Snake (Daboia russelli pulchella) [48630] (7 PDB entries)
  8. 286231Domain d1fb2b_: 1fb2 B: [59759]

Details for d1fb2b_

PDB Entry: 1fb2 (more details), 1.95 Å

PDB Description: structure of phospholipase a2 from daboia russelli pulchella at 1.95

SCOP Domain Sequences for d1fb2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb2b_ a.133.1.2 (B:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d1fb2b_:

Click to download the PDB-style file with coordinates for d1fb2b_.
(The format of our PDB-style files is described here.)

Timeline for d1fb2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fb2a_