Lineage for d1faza_ (1faz A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1282888Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1282889Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1283403Family a.133.1.3: Prokaryotic phospholipase A2 [63630] (1 protein)
    automatically mapped to Pfam PF09056
  6. 1283404Protein Prokaryotic phospholipase A2 [63631] (1 species)
  7. 1283405Species Streptomyces violaceoruber [TaxId:1935] [63632] (5 PDB entries)
  8. 1283407Domain d1faza_: 1faz A: [59757]

Details for d1faza_

PDB Entry: 1faz (more details), 1.4 Å

PDB Description: the crystal structure of prokaryotic phospholipase a2
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1faza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faza_ a.133.1.3 (A:) Prokaryotic phospholipase A2 {Streptomyces violaceoruber [TaxId: 1935]}
apadkpqvlasftqtsassqnawlaanrnqsawaayefdwstdlctqapdnpfgfpfnta
carhdfgyrnykaagsfdanksridsafyedmkrvctgytgekntacnstawtyyqavki
fg

SCOPe Domain Coordinates for d1faza_:

Click to download the PDB-style file with coordinates for d1faza_.
(The format of our PDB-style files is described here.)

Timeline for d1faza_: