SCOPe 2.03: Domain d1faza_: 1faz A:

Lineage for d1faza_ (1faz A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.3: Prokaryotic phospholipase A2 [63630] (1 protein)
   automatically mapped to Pfam PF09056

6. Protein Prokaryotic phospholipase A2 [63631] (1 species)

7. Species Streptomyces violaceoruber [TaxId:1935] [63632] (5 PDB entries)

8. Domain d1faza_: 1faz A: [59757]

Details for d1faza_

PDB Entry: 1faz, 1.4 Å

PDB Description: the crystal structure of prokaryotic phospholipase a2

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1faza_:

Sequence; same for both SEQRES and ATOM records:

>d1faza_ a.133.1.3 (A:) Prokaryotic phospholipase A2 {Streptomyces violaceoruber [TaxId: 1935]}
apadkpqvlasftqtsassqnawlaanrnqsawaayefdwstdlctqapdnpfgfpfnta
carhdfgyrnykaagsfdanksridsafyedmkrvctgytgekntacnstawtyyqavki
fg

Timeline for d1faza_:

• d1faza_ first appeared in SCOP 1.57
  
• d1faza_ appears in SCOPe 2.02
  
• d1faza_ appears in SCOPe 2.04
  
• d1faza_ appears in the current release, SCOPe 2.08