Lineage for d1fayh_ (1fay H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164502Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 164615Protein Legume lectin [49904] (20 species)
  7. 164784Species Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId:3891] [63728] (2 PDB entries)
  8. 164794Domain d1fayh_: 1fay H: [59756]

Details for d1fayh_

PDB Entry: 1fay (more details), 3.3 Å

PDB Description: winged bean acidic lectin complexed with methyl-alpha-d-galactose (monoclinic form)

SCOP Domain Sequences for d1fayh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fayh_ b.29.1.1 (H:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin}
etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe

SCOP Domain Coordinates for d1fayh_:

Click to download the PDB-style file with coordinates for d1fayh_.
(The format of our PDB-style files is described here.)

Timeline for d1fayh_: