Lineage for d1fayg_ (1fay G:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794082Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 794214Protein Legume lectin [49904] (23 species)
  7. 794551Species Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId:3891] [63728] (2 PDB entries)
  8. 794560Domain d1fayg_: 1fay G: [59755]

Details for d1fayg_

PDB Entry: 1fay (more details), 3.3 Å

PDB Description: winged bean acidic lectin complexed with methyl-alpha-d-galactose (monoclinic form)
PDB Compounds: (G:) acidic lectin

SCOP Domain Sequences for d1fayg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fayg_ b.29.1.1 (G:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]}
etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe

SCOP Domain Coordinates for d1fayg_:

Click to download the PDB-style file with coordinates for d1fayg_.
(The format of our PDB-style files is described here.)

Timeline for d1fayg_: