Lineage for d1faye_ (1fay E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1779938Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1780101Protein Legume lectin [49904] (23 species)
  7. 1780396Species Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId:3891] [63728] (2 PDB entries)
  8. 1780403Domain d1faye_: 1fay E: [59753]
    complexed with amg, ca, mn

Details for d1faye_

PDB Entry: 1fay (more details), 3.3 Å

PDB Description: winged bean acidic lectin complexed with methyl-alpha-d-galactose (monoclinic form)
PDB Compounds: (E:) acidic lectin

SCOPe Domain Sequences for d1faye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faye_ b.29.1.1 (E:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]}
etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe

SCOPe Domain Coordinates for d1faye_:

Click to download the PDB-style file with coordinates for d1faye_.
(The format of our PDB-style files is described here.)

Timeline for d1faye_: