Lineage for d1fayc_ (1fay C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371494Species Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId:3891] [63728] (2 PDB entries)
  8. 371499Domain d1fayc_: 1fay C: [59751]

Details for d1fayc_

PDB Entry: 1fay (more details), 3.3 Å

PDB Description: winged bean acidic lectin complexed with methyl-alpha-d-galactose (monoclinic form)

SCOP Domain Sequences for d1fayc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fayc_ b.29.1.1 (C:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin}
etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftsslqe

SCOP Domain Coordinates for d1fayc_:

Click to download the PDB-style file with coordinates for d1fayc_.
(The format of our PDB-style files is described here.)

Timeline for d1fayc_: