Lineage for d1f9xa_ (1f9x A:)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) 
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (3 proteins) Protein BIR domains of XIAP [57928] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57929] (5 PDB entries) 
Domain d1f9xa_: 1f9x A: [59748]
Details for d1f9xa_
PDB Entry: 1f9x (more details)
PDB Description: average nmr solution structure of the bir-3 domain of xiap
SCOP Domain Sequences for d1f9xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f9xa_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens)}
msdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvk
cfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt
SCOP Domain Coordinates for d1f9xa_:
Click to download the PDB-style file with coordinates for d1f9xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f9xa_:
- d1f9xa_ is new in SCOP 1.57
- d1f9xa_ appears in SCOP 1.59
- d1f9xa_ appears in the current release, SCOPe 2.08, called d1f9xa1
View in 3D