| Class g: Small proteins [56992] (56 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (3 proteins) |
| Protein BIR domains of XIAP [57928] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57929] (5 PDB entries) |
| Domain d1f9xa_: 1f9x A: [59748] |
PDB Entry: 1f9x (more details)
SCOP Domain Sequences for d1f9xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f9xa_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens)}
msdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvk
cfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt
Timeline for d1f9xa_: