Lineage for d1f9xa1 (1f9x A:241-356)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038108Protein BIR domains of XIAP [57928] (1 species)
  7. 3038109Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries)
    Uniprot P98170 241-356
  8. 3038144Domain d1f9xa1: 1f9x A:241-356 [59748]
    Other proteins in same PDB: d1f9xa2
    BIR3 domain
    complexed with zn

    has additional insertions and/or extensions that are not grouped together

Details for d1f9xa1

PDB Entry: 1f9x (more details)

PDB Description: average nmr solution structure of the bir-3 domain of xiap
PDB Compounds: (A:) inhibitor of apoptosis protein xiap

SCOPe Domain Sequences for d1f9xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9xa1 g.52.1.1 (A:241-356) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
sdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkc
fhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt

SCOPe Domain Coordinates for d1f9xa1:

Click to download the PDB-style file with coordinates for d1f9xa1.
(The format of our PDB-style files is described here.)

Timeline for d1f9xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f9xa2