| Class g: Small proteins [56992] (100 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
| Protein BIR domains of XIAP [57928] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57929] (15 PDB entries) Uniprot P98170 241-356 |
| Domain d1f9xa1: 1f9x A:241-356 [59748] Other proteins in same PDB: d1f9xa2 BIR3 domain complexed with zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1f9x (more details)
SCOPe Domain Sequences for d1f9xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f9xa1 g.52.1.1 (A:241-356) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
sdavssdrnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkc
fhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt
Timeline for d1f9xa1: