Lineage for d1f9wb_ (1f9w B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111634Protein Kinesin motor Ncd (non-claret disjunctional) [52649] (2 species)
    contains coiled-coil neck
  7. 2111635Species Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId:4932] [52651] (5 PDB entries)
    kinesin-like protein
  8. 2111641Domain d1f9wb_: 1f9w B: [59747]
    complexed with adp, mg; mutant

Details for d1f9wb_

PDB Entry: 1f9w (more details), 2.5 Å

PDB Description: crystal structures of mutants reveal a signalling pathway for activation of the kinesin motor atpase
PDB Compounds: (B:) kinesin-like protein kar3

SCOPe Domain Sequences for d1f9wb_:

Sequence, based on SEQRES records: (download)

>d1f9wb_ c.37.1.9 (B:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]}
gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
klktkgwdykvncefieiynenivdllrsdnnnkedtsiglkheirhdqetktttitnvt
sckleseemveiilkkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnl
vdlagsarinvsqvvgdrlretqninkslsclgdvihalgqpdstkrhipfrnskltyll
qysltgdsktlmfvnispssshinetlnslrfaskvns

Sequence, based on observed residues (ATOM records): (download)

>d1f9wb_ c.37.1.9 (B:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]}
gnirvycrirpalknledtslinvnefddnsgvqsmevtvhefkfdkifdqqdtnvdvfk
evgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwinklktkgwdy
kvncefieiynenivdllrlkheirhdqetktttitnvtsckleseemveiilkkanklr
sthssrshsifiihlsgsnaktgahsygtlnlvdlagsarlretqninkslsclgdviha
lgqpdstkrhipfrnskltyllqysltgdsktlmfvnispssshinetlnslrfaskvns

SCOPe Domain Coordinates for d1f9wb_:

Click to download the PDB-style file with coordinates for d1f9wb_.
(The format of our PDB-style files is described here.)

Timeline for d1f9wb_: