Lineage for d1f9ua_ (1f9u A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69902Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 69916Protein Kinesin motor Ncd (non-claret disjunctional) [52649] (2 species)
  7. 69917Species Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId:4932] [52651] (5 PDB entries)
  8. 69920Domain d1f9ua_: 1f9u A: [59744]

Details for d1f9ua_

PDB Entry: 1f9u (more details), 1.7 Å

PDB Description: crystal structures of mutants reveal a signalling pathway for activation of the kinesin motor atpase

SCOP Domain Sequences for d1f9ua_:

Sequence, based on SEQRES records: (download)

>d1f9ua_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar}
gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
klktkgwdykvncefieiynenivdllrsdnnnkedtsiglkheirhdqetktttitnvt
sckleseemveiilkkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnl
vdlagserinvsqvvgdrlretqnikkslsclgdvihalgqpdstkrhipfrnskltyll
qysltgdsktlmfvnispssshinetlnslrfaskvns

Sequence, based on observed residues (ATOM records): (download)

>d1f9ua_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar}
gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
klktkgwdykvncefieiynenivdllkheirhdqetktttitnvtsckleseemveiil
kkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnlvdlagserrlretq
nikkslsclgdvihalgqphipfrnskltyllqysltgdsktlmfvnispssshinetln
slrfaskvns

SCOP Domain Coordinates for d1f9ua_:

Click to download the PDB-style file with coordinates for d1f9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1f9ua_: