SCOP 1.67: Domain d1f9kb_: 1f9k B:

Lineage for d1f9kb_ (1f9k B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId:3891] [63728] (2 PDB entries)

8. Domain d1f9kb_: 1f9k B: [59742]
   complexed with amg, ca, man, mn, nag

Details for d1f9kb_

PDB Entry: 1f9k, 3 Å

PDB Description: winged bean acidic lectin complexed with methyl-alpha-d-galactose

SCOP Domain Sequences for d1f9kb_:

Sequence; same for both SEQRES and ATOM records:

>d1f9kb_ b.29.1.1 (B:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin}
etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftssl

Timeline for d1f9kb_:

• d1f9kb_ first appeared in SCOP 1.57
  
• d1f9kb_ appears in SCOP 1.65
  
• d1f9kb_ appears in SCOP 1.69
  
• d1f9kb_ appears in the current release, SCOPe 2.08