Lineage for d1f9ka_ (1f9k A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371494Species Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId:3891] [63728] (2 PDB entries)
  8. 371495Domain d1f9ka_: 1f9k A: [59741]

Details for d1f9ka_

PDB Entry: 1f9k (more details), 3 Å

PDB Description: winged bean acidic lectin complexed with methyl-alpha-d-galactose

SCOP Domain Sequences for d1f9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin}
etqsfnfdhfeenskelnlqrqasiksngvleltkltkngvpvwkstgralyaepikiwd
sttgnvasfetrfsfnitqpyaypepadgltffmvppnspqgedggnlgvfkppegdnaf
avefdtfqntwdpqvphigidvnsivssktlhfqlenggvanvvikydsptkilnvvlaf
hsvgtvytlsnivdlkqefpnsewvnvglsattgyqknavetheiiswsftssl

SCOP Domain Coordinates for d1f9ka_:

Click to download the PDB-style file with coordinates for d1f9ka_.
(The format of our PDB-style files is described here.)

Timeline for d1f9ka_: