Lineage for d1f9ga3 (1f9g A:541-814)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109241Superfamily b.30.3: Hyaluronate lyase-like, central domain [50005] (1 family) (S)
  5. 109242Family b.30.3.1: Hyaluronate lyase-like, central domain [50006] (2 proteins)
  6. 109250Protein Hyaluronate lyase [50009] (2 species)
  7. 109254Species Streptococcus pneumoniae [TaxId:1313] [50010] (3 PDB entries)
  8. 109257Domain d1f9ga3: 1f9g A:541-814 [59740]
    Other proteins in same PDB: d1f9ga1, d1f9ga2

Details for d1f9ga3

PDB Entry: 1f9g (more details), 2 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase cocrystallized with ascorbic acid
PDB Compounds: (A:)

SCOP Domain Sequences for d1f9ga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9ga3 b.30.3.1 (A:541-814) Hyaluronate lyase {Streptococcus pneumoniae}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

SCOP Domain Coordinates for d1f9ga3:

Click to download the PDB-style file with coordinates for d1f9ga3.
(The format of our PDB-style files is described here.)

Timeline for d1f9ga3: