Lineage for d1f9ga1 (1f9g A:170-540)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100027Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 100096Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
  5. 100102Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (2 proteins)
  6. 100110Protein Hyaluronate lyase [48237] (2 species)
  7. 100114Species Streptococcus pneumoniae [TaxId:1313] [48238] (3 PDB entries)
  8. 100117Domain d1f9ga1: 1f9g A:170-540 [59738]
    Other proteins in same PDB: d1f9ga2, d1f9ga3

Details for d1f9ga1

PDB Entry: 1f9g (more details), 2 Å

PDB Description: crystal structure of streptococcus pneumoniae hyaluronate lyase cocrystallized with ascorbic acid
PDB Compounds: (A:)

SCOP Domain Sequences for d1f9ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9ga1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOP Domain Coordinates for d1f9ga1:

Click to download the PDB-style file with coordinates for d1f9ga1.
(The format of our PDB-style files is described here.)

Timeline for d1f9ga1: