Lineage for d1f9e.6 (1f9e K:,L:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854798Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2854799Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2854800Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)
  6. 2854877Protein Caspase-8 [52135] (1 species)
  7. 2854878Species Human (Homo sapiens) [TaxId:9606] [52136] (8 PDB entries)
  8. 2854895Domain d1f9e.6: 1f9e K:,L: [59737]

Details for d1f9e.6

PDB Entry: 1f9e (more details), 2.9 Å

PDB Description: caspase-8 specificity probed at subsite s4: crystal structure of the caspase-8-z-devd-cho
PDB Compounds: (K:) caspase-8 alpha chain, (L:) caspase-8 beta chain

SCOPe Domain Sequences for d1f9e.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g1f9e.6 c.17.1.1 (K:,L:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]}
ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei
kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft
glkcpslagkpkvffiqacqgdnyqkgipvetdXtryipdeadfllgmatvnncvsyrnp
aegtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkqmpqptftlrkklv
fps

SCOPe Domain Coordinates for d1f9e.6:

Click to download the PDB-style file with coordinates for d1f9e.6.
(The format of our PDB-style files is described here.)

Timeline for d1f9e.6: