Lineage for d1f9cb2 (1f9c B:3-130)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191245Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2191454Protein Muconate-lactonizing enzyme (cis muconate cycloisomerase) [54836] (1 species)
  7. 2191455Species Pseudomonas putida [TaxId:303] [54837] (5 PDB entries)
  8. 2191466Domain d1f9cb2: 1f9c B:3-130 [59731]
    Other proteins in same PDB: d1f9ca1, d1f9cb1
    complexed with mn

Details for d1f9cb2

PDB Entry: 1f9c (more details), 2.5 Å

PDB Description: crystal structure of mle d178n variant
PDB Compounds: (B:) protein (muconate cycloisomerase I)

SCOPe Domain Sequences for d1f9cb2:

Sequence, based on SEQRES records: (download)

>d1f9cb2 d.54.1.1 (B:3-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida [TaxId: 303]}
salieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglaygye
spegikanidahlapaliglaadninaamlkldalakgntfaksgiesalldaqgkrlgl
pvsellgg

Sequence, based on observed residues (ATOM records): (download)

>d1f9cb2 d.54.1.1 (B:3-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida [TaxId: 303]}
salieridaiivdlptiqqqtlvvlrvrcsdgvegigeattigglaygyespegikanid
ahlapaliglaadninaamlkldalakgntfaksgiesalldaqgkrlglpvsellgg

SCOPe Domain Coordinates for d1f9cb2:

Click to download the PDB-style file with coordinates for d1f9cb2.
(The format of our PDB-style files is described here.)

Timeline for d1f9cb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f9cb1