Lineage for d1f9ca2 (1f9c A:3-130)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602968Protein Muconate-lactonizing enzyme (cis muconate cycloisomerase) [54836] (1 species)
  7. 602969Species Pseudomonas putida [TaxId:303] [54837] (5 PDB entries)
  8. 602979Domain d1f9ca2: 1f9c A:3-130 [59729]
    Other proteins in same PDB: d1f9ca1, d1f9cb1

Details for d1f9ca2

PDB Entry: 1f9c (more details), 2.5 Å

PDB Description: crystal structure of mle d178n variant
PDB Compounds: (A:)

SCOP Domain Sequences for d1f9ca2:

Sequence, based on SEQRES records: (download)

>d1f9ca2 d.54.1.1 (A:3-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida}
salieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglaygye
spegikanidahlapaliglaadninaamlkldalakgntfaksgiesalldaqgkrlgl
pvsellgg

Sequence, based on observed residues (ATOM records): (download)

>d1f9ca2 d.54.1.1 (A:3-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida}
salieridaiivdlptiqqqtlvvlrvrcsdgvegigeattigglaygyespegikanid
ahlapaliglaadninaamlkldalakgntfaksgiesalldaqgkrlglpvsellgg

SCOP Domain Coordinates for d1f9ca2:

Click to download the PDB-style file with coordinates for d1f9ca2.
(The format of our PDB-style files is described here.)

Timeline for d1f9ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f9ca1