SCOPe 2.05: Domain d1f99n_: 1f99 N:

Lineage for d1f99n_ (1f99 N:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin beta subunit [88940] (8 species)

7. Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88942] (1 PDB entry)

8. Domain d1f99n_: 1f99 N: [59727]
   Other proteins in same PDB: d1f99a_, d1f99k_, d1f99m_
   complexed with bla, cyc, peb

Details for d1f99n_

PDB Entry: 1f99, 2.4 Å

PDB Description: crystal structure of r-phycocyanin from polysiphonia at 2.4 a resolution

PDB Compounds: (N:) r-phycocyanin

SCOPe Domain Sequences for d1f99n_:

Sequence; same for both SEQRES and ATOM records:

>d1f99n_ a.1.1.3 (N:) Phycocyanin beta subunit {Red alga (Polysiphonia urceolata) [TaxId: 65404]}
mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf
aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal
gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava

Timeline for d1f99n_:

• d1f99n_ first appeared in SCOP 1.57
  
• d1f99n_ appears in SCOPe 2.04
  
• d1f99n_ appears in SCOPe 2.06
  
• d1f99n_ appears in the current release, SCOPe 2.08