SCOPe 2.06: Domain d1f99m_: 1f99 M:

Lineage for d1f99m_ (1f99 M:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (9 species)

7. Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88936] (1 PDB entry)

8. Domain d1f99m_: 1f99 M: [59726]
   Other proteins in same PDB: d1f99b_, d1f99l_, d1f99n_
   complexed with bla, cyc, peb

Details for d1f99m_

PDB Entry: 1f99, 2.4 Å

PDB Description: crystal structure of r-phycocyanin from polysiphonia at 2.4 a resolution

PDB Compounds: (M:) r-phycocyanin

SCOPe Domain Sequences for d1f99m_:

Sequence; same for both SEQRES and ATOM records:

>d1f99m_ a.1.1.3 (M:) Phycocyanin alpha subunit {Red alga (Polysiphonia urceolata) [TaxId: 65404]}
mktplteaiaaadsqgrflsntelqvvngrynratssleaakaltanadrlisgaanavy
skfpyttqmpgpnysstaigkakcardigyylrmvtyclvvggtgpmddylvagleeinr
tfelspswyiealkyiknnhglsgdvaneantyidyaintls

Timeline for d1f99m_:

• d1f99m_ first appeared in SCOP 1.57
  
• d1f99m_ appears in SCOPe 2.05
  
• d1f99m_ appears in SCOPe 2.07
  
• d1f99m_ appears in the current release, SCOPe 2.08