SCOP 1.57: Domain d1f99b_: 1f99 B:

Lineage for d1f99b_ (1f99 B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)

6. Protein Phycocyanin [46533] (5 species)

7. Species Red alga (Polysiphonia urceolata) [TaxId:65404] [63442] (1 PDB entry)

8. Domain d1f99b_: 1f99 B: [59723]

Details for d1f99b_

PDB Entry: 1f99, 2.4 Å

PDB Description: crystal structure of r-phycocyanin from polysiphonia at 2.4 a resolution

SCOP Domain Sequences for d1f99b_:

Sequence; same for both SEQRES and ATOM records:

>d1f99b_ a.1.1.3 (B:) Phycocyanin {Red alga (Polysiphonia urceolata)}
mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf
aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal
gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava

Timeline for d1f99b_:

• d1f99b_ is new in SCOP 1.57
  
• d1f99b_ appears in SCOP 1.59
  
• d1f99b_ appears in the current release, SCOPe 2.08