Lineage for d1f99b_ (1f99 B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 44707Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)
  6. 44725Protein Phycocyanin [46533] (5 species)
  7. 44734Species Red alga (Polysiphonia urceolata) [TaxId:65404] [63442] (1 PDB entry)
  8. 44736Domain d1f99b_: 1f99 B: [59723]

Details for d1f99b_

PDB Entry: 1f99 (more details), 2.4 Å

PDB Description: crystal structure of r-phycocyanin from polysiphonia at 2.4 a resolution

SCOP Domain Sequences for d1f99b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f99b_ a.1.1.3 (B:) Phycocyanin {Red alga (Polysiphonia urceolata)}
mldafakvvaqadargeflsntqidallaivsegnkrldvvnkitnnasaivtnaaralf
aeqpqlispggnaytsrrmaaclrdmeivlryvsyamiagdasvlddrclnglretyqal
gtpgasvavaiqkmkdaalalvndttgtpagdcaslvaeiatyfdraaaava

SCOP Domain Coordinates for d1f99b_:

Click to download the PDB-style file with coordinates for d1f99b_.
(The format of our PDB-style files is described here.)

Timeline for d1f99b_: