Lineage for d1f92a_ (1f92 A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins) 
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50587] (9 PDB entries) 
Domain d1f92a_: 1f92 A: [59721]
Details for d1f92a_
PDB Entry: 1f92 (more details), 2.6 Å
PDB Description: urokinase plasminogen activator b chain-uki-1d complex
SCOP Domain Sequences for d1f92a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f92a_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke
SCOP Domain Coordinates for d1f92a_:
Click to download the PDB-style file with coordinates for d1f92a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f92a_:
- d1f92a_ is new in SCOP 1.57
- d1f92a_ appears in SCOP 1.59
- d1f92a_ appears in the current release, SCOPe 2.08
View in 3D