Lineage for d1f91b2 (1f91 B:254-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916496Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species)
  7. 2916497Species Escherichia coli [TaxId:562] [419487] (19 PDB entries)
    Uniprot P14926
  8. 2916519Domain d1f91b2: 1f91 B:254-406 [59716]
    Other proteins in same PDB: d1f91a1, d1f91b1, d1f91c1, d1f91d1
    complexed with dka, oh

Details for d1f91b2

PDB Entry: 1f91 (more details), 2.4 Å

PDB Description: beta-ketoacyl-[acyl-carrier-protein] synthase i in complex with c10 fatty acid substrate
PDB Compounds: (B:) beta-ketoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d1f91b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f91b2 c.95.1.1 (B:254-406) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOPe Domain Coordinates for d1f91b2:

Click to download the PDB-style file with coordinates for d1f91b2.
(The format of our PDB-style files is described here.)

Timeline for d1f91b2: