SCOP 1.61: Domain d1f90l2: 1f90 L:108-214

Lineage for d1f90l2 (1f90 L:108-214)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Anti-IL2 Fab LNKB-2, (mouse), kappa L chain [63655] (2 PDB entries)

8. Domain d1f90l2: 1f90 L:108-214 [59712]
   Other proteins in same PDB: d1f90h1, d1f90l1

Details for d1f90l2

PDB Entry: 1f90, 2.6 Å

PDB Description: fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide

SCOP Domain Sequences for d1f90l2:

Sequence; same for both SEQRES and ATOM records:

>d1f90l2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-IL2 Fab LNKB-2, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1f90l2:

• d1f90l2 first appeared in SCOP 1.57
  
• d1f90l2 appears in SCOP 1.59
  
• d1f90l2 appears in SCOP 1.63
  
• d1f90l2 appears in the current release, SCOPe 2.08