SCOP 1.61: Domain d1f90l1: 1f90 L:1-107

Lineage for d1f90l1 (1f90 L:1-107)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anti-IL2 Fab LNKB-2, (mouse), kappa L chain [63643] (2 PDB entries)

8. Domain d1f90l1: 1f90 L:1-107 [59711]
   Other proteins in same PDB: d1f90h2, d1f90l2

Details for d1f90l1

PDB Entry: 1f90, 2.6 Å

PDB Description: fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide

SCOP Domain Sequences for d1f90l1:

Sequence; same for both SEQRES and ATOM records:

>d1f90l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-IL2 Fab LNKB-2, (mouse), kappa L chain}
dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleik

Timeline for d1f90l1:

• d1f90l1 first appeared in SCOP 1.57
  
• d1f90l1 appears in SCOP 1.59
  
• d1f90l1 appears in SCOP 1.63
  
• d1f90l1 appears in the current release, SCOPe 2.08