![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species Anti-IL2 Fab LNKB-2, (mouse), kappa L chain [63643] (2 PDB entries) |
![]() | Domain d1f90l1: 1f90 L:1-107 [59711] Other proteins in same PDB: d1f90h2, d1f90l2 |
PDB Entry: 1f90 (more details), 2.6 Å
SCOP Domain Sequences for d1f90l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f90l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-IL2 Fab LNKB-2, (mouse), kappa L chain} dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleik
Timeline for d1f90l1: