SCOP 1.65: Domain d1f90h2: 1f90 H:114-230

Lineage for d1f90h2 (1f90 H:114-230)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d1f90h2: 1f90 H:114-230 [59710]
   Other proteins in same PDB: d1f90h1, d1f90l1, d1f90l2
   part of anti-IL2 Fab LNKB-2

Details for d1f90h2

PDB Entry: 1f90, 2.6 Å

PDB Description: fab fragment of monoclonal antibody (lnkb-2) against human interleukin-2 in complex with antigenic peptide

SCOP Domain Sequences for d1f90h2:

Sequence; same for both SEQRES and ATOM records:

>d1f90h2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1f90h2:

• d1f90h2 first appeared in SCOP 1.57
  
• d1f90h2 appears in SCOP 1.63
  
• d1f90h2 appears in SCOP 1.67
  
• d1f90h2 appears in the current release, SCOPe 2.08