Lineage for d1f8tl1 (1f8t L:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653212Domain d1f8tl1: 1f8t L:1-107 [59707]
    Other proteins in same PDB: d1f8th1, d1f8th2, d1f8tl2
    part of anti-IL2 Fab LNKB-2

Details for d1f8tl1

PDB Entry: 1f8t (more details), 2.2 Å

PDB Description: fab (lnkb-2) of monoclonal antibody, crystal structure
PDB Compounds: (L:) antibody fab fragment (light chain)

SCOP Domain Sequences for d1f8tl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8tl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvqmtqtpltlsvtigqpasiscessqsllysngktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlrisrveaedlgvyycvqgthfprtfgggtkleik

SCOP Domain Coordinates for d1f8tl1:

Click to download the PDB-style file with coordinates for d1f8tl1.
(The format of our PDB-style files is described here.)

Timeline for d1f8tl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f8tl2