SCOP 1.69: Domain d1f8th1: 1f8t H:1-113

Lineage for d1f8th1 (1f8t H:1-113)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (34 PDB entries)

8. Domain d1f8th1: 1f8t H:1-113 [59705]
   Other proteins in same PDB: d1f8th2, d1f8tl1, d1f8tl2
   part of anti-IL2 Fab LNKB-2

Details for d1f8th1

PDB Entry: 1f8t, 2.2 Å

PDB Description: fab (lnkb-2) of monoclonal antibody, crystal structure

SCOP Domain Sequences for d1f8th1:

Sequence; same for both SEQRES and ATOM records:

>d1f8th1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
gvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgstgy
npslksrisitrdtsknqfflqlnsvttedtatyycasyddytwftywgqgtlvtvsa

Timeline for d1f8th1:

• d1f8th1 first appeared in SCOP 1.57
  
• d1f8th1 appears in SCOP 1.67
  
• d1f8th1 appears in SCOP 1.71
  
• d1f8th1 appears in the current release, SCOPe 2.08