Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) |
Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins) |
Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species) L-alanine dehydrogenase homologue |
Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries) |
Domain d1f8gd2: 1f8g D:1-143,D:327-380 [59702] Other proteins in same PDB: d1f8ga1, d1f8gb1, d1f8gc1, d1f8gd1 complexed with nad |
PDB Entry: 1f8g (more details), 2 Å
SCOP Domain Sequences for d1f8gd2:
Sequence, based on SEQRES records: (download)
>d1f8gd2 c.23.12.2 (D:1-143,D:327-380) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet vsgtcvtrdgaivhpalt
>d1f8gd2 c.23.12.2 (D:1-143,D:327-380) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdktlvmkledetvsg tcvtrdgaivhpalt
Timeline for d1f8gd2: