Lineage for d1f8gd2 (1f8g D:1-143,D:327-380)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857723Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 2857729Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. 2857730Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)
  8. 2857746Domain d1f8gd2: 1f8g D:1-143,D:327-380 [59702]
    Other proteins in same PDB: d1f8ga1, d1f8gb1, d1f8gc1, d1f8gd1
    complexed with nad

Details for d1f8gd2

PDB Entry: 1f8g (more details), 2 Å

PDB Description: the x-ray structure of nicotinamide nucleotide transhydrogenase from rhodospirillum rubrum complexed with nad+
PDB Compounds: (D:) nicotinamide nucleotide transhydrogenase

SCOPe Domain Sequences for d1f8gd2:

Sequence, based on SEQRES records: (download)

>d1f8gd2 c.23.12.2 (D:1-143,D:327-380) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpalt

Sequence, based on observed residues (ATOM records): (download)

>d1f8gd2 c.23.12.2 (D:1-143,D:327-380) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdktlvmkledetvsg
tcvtrdgaivhpalt

SCOPe Domain Coordinates for d1f8gd2:

Click to download the PDB-style file with coordinates for d1f8gd2.
(The format of our PDB-style files is described here.)

Timeline for d1f8gd2: