SCOP 1.75: Domain d1f8gc1: 1f8g C:144-326

Lineage for d1f8gc1 (1f8g C:144-326)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries)

8. Domain d1f8gc1: 1f8g C:144-326 [59699]
   Other proteins in same PDB: d1f8ga2, d1f8gb2, d1f8gc2, d1f8gd2

Details for d1f8gc1

PDB Entry: 1f8g, 2 Å

PDB Description: the x-ray structure of nicotinamide nucleotide transhydrogenase from rhodospirillum rubrum complexed with nad+

PDB Compounds: (C:) nicotinamide nucleotide transhydrogenase

SCOP Domain Sequences for d1f8gc1:

Sequence; same for both SEQRES and ATOM records:

>d1f8gc1 c.2.1.4 (C:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Timeline for d1f8gc1:

• d1f8gc1 first appeared in SCOP 1.57
  
• d1f8gc1 appears in SCOP 1.73
  
• d1f8gc1 appears in SCOPe 2.01
  
• d1f8gc1 appears in the current release, SCOPe 2.08