Lineage for d1f8gb2 (1f8g B:1-143,B:327-384)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692394Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 692453Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 692459Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. 692460Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)
  8. 692466Domain d1f8gb2: 1f8g B:1-143,B:327-384 [59698]
    Other proteins in same PDB: d1f8ga1, d1f8gb1, d1f8gc1, d1f8gd1

Details for d1f8gb2

PDB Entry: 1f8g (more details), 2 Å

PDB Description: the x-ray structure of nicotinamide nucleotide transhydrogenase from rhodospirillum rubrum complexed with nad+
PDB Compounds: (B:) nicotinamide nucleotide transhydrogenase

SCOP Domain Sequences for d1f8gb2:

Sequence, based on SEQRES records: (download)

>d1f8gb2 c.23.12.2 (B:1-143,B:327-384) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpaltgqga

Sequence, based on observed residues (ATOM records): (download)

>d1f8gb2 c.23.12.2 (B:1-143,B:327-384) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdktlvmkledetvsg
tcvtrdgaivhpaltgqga

SCOP Domain Coordinates for d1f8gb2:

Click to download the PDB-style file with coordinates for d1f8gb2.
(The format of our PDB-style files is described here.)

Timeline for d1f8gb2: