Lineage for d1f8ga2 (1f8g A:1-143,A:327-384)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68583Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 68610Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 68616Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
  7. 68617Species Rhodospirillum rubrum [TaxId:1085] [63964] (2 PDB entries)
  8. 68618Domain d1f8ga2: 1f8g A:1-143,A:327-384 [59696]
    Other proteins in same PDB: d1f8ga1, d1f8gb1, d1f8gc1, d1f8gd1

Details for d1f8ga2

PDB Entry: 1f8g (more details), 2 Å

PDB Description: the x-ray structure of nicotinamide nucleotide transhydrogenase from rhodospirillum rubrum complexed with nad+

SCOP Domain Sequences for d1f8ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8ga2 c.23.12.2 (A:1-143,A:327-384) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpaltgqga

SCOP Domain Coordinates for d1f8ga2:

Click to download the PDB-style file with coordinates for d1f8ga2.
(The format of our PDB-style files is described here.)

Timeline for d1f8ga2: