Lineage for d1f8ea_ (1f8e A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62715Fold b.68: 6-bladed beta-propeller [50938] (6 superfamilies)
  4. 62716Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 62717Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 62718Protein Influenza neuraminidase [50943] (2 species)
  7. 62719Species Influenza A virus, different strains [TaxId:11320] [50944] (45 PDB entries)
  8. 62720Domain d1f8ea_: 1f8e A: [59694]

Details for d1f8ea_

PDB Entry: 1f8e (more details), 1.4 Å

PDB Description: Native Influenza Neuraminidase in Complex with 4,9-diamino-2-deoxy-2,3-dehydro-N-acetyl-neuraminic Acid

SCOP Domain Sequences for d1f8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8ea_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains}
rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwdwpdgakieyfl

SCOP Domain Coordinates for d1f8ea_:

Click to download the PDB-style file with coordinates for d1f8ea_.
(The format of our PDB-style files is described here.)

Timeline for d1f8ea_: