Lineage for d1f86b_ (1f86 B:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) 
Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein) Protein Transthyretin (synonym: prealbumin) [49474] (3 species) Species Human (Homo sapiens) [TaxId:9606] [49475] (38 PDB entries) 
Domain d1f86b_: 1f86 B: [59690]
Details for d1f86b_
PDB Entry: 1f86 (more details), 1.1 Å
PDB Description: transthyretin thr119met protein stabilisation
SCOP Domain Sequences for d1f86b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f86b_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtn
SCOP Domain Coordinates for d1f86b_:
Click to download the PDB-style file with coordinates for d1f86b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f86b_:
- d1f86b_ is new in SCOP 1.57
- d1f86b_ appears in SCOP 1.59
- d1f86b_ appears in the current release, SCOPe 2.08
View in 3D
