SCOPe 2.03: Domain d1f80c_: 1f80 C:

Lineage for d1f80c_ (1f80 C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
   forms trimers with three closely packed beta-sheets similar to the IspF trimers
   automatically mapped to Pfam PF01648

6. Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)

8. Domain d1f80c_: 1f80 C: [59685]
   Other proteins in same PDB: d1f80d_, d1f80e_, d1f80f_
   complexed with holo-ACP
   complexed with na

Details for d1f80c_

PDB Entry: 1f80, 2.3 Å

PDB Description: holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)

PDB Compounds: (C:) holo-(acyl carrier protein) synthase

SCOPe Domain Sequences for d1f80c_:

Sequence; same for both SEQRES and ATOM records:

>d1f80c_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]}
ygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafsk
afgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvier

Timeline for d1f80c_:

• d1f80c_ first appeared in SCOP 1.57
  
• d1f80c_ appears in SCOPe 2.02
  
• d1f80c_ appears in SCOPe 2.04
  
• d1f80c_ appears in the current release, SCOPe 2.08