Lineage for d1f80c_ (1f80 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 612630Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 612631Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (2 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 612637Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to the IspF trimers
  6. 612638Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 612639Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)
  8. 612649Domain d1f80c_: 1f80 C: [59685]
    Other proteins in same PDB: d1f80d_, d1f80e_, d1f80f_
    complexed with holo-ACP
    complexed with na, pn2; mutant

Details for d1f80c_

PDB Entry: 1f80 (more details), 2.3 Å

PDB Description: holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)

SCOP Domain Sequences for d1f80c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f80c_ d.150.1.2 (C:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis}
ygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafsk
afgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvier

SCOP Domain Coordinates for d1f80c_:

Click to download the PDB-style file with coordinates for d1f80c_.
(The format of our PDB-style files is described here.)

Timeline for d1f80c_: