Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein) forms trimers with three closely packed beta-sheets similar to the IspF trimers automatically mapped to Pfam PF01648 |
Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species) |
Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries) |
Domain d1f80a_: 1f80 A: [59683] Other proteins in same PDB: d1f80d1, d1f80d2, d1f80e_, d1f80f_ complexed with holo-ACP complexed with na |
PDB Entry: 1f80 (more details), 2.3 Å
SCOPe Domain Sequences for d1f80a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f80a_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]} aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierl
Timeline for d1f80a_: