Lineage for d1f80a_ (1f80 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548368Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 2548369Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 2548379Family d.150.1.2: Holo-(acyl carrier protein) synthase ACPS [64418] (1 protein)
    forms trimers with three closely packed beta-sheets similar to the IspF trimers
    automatically mapped to Pfam PF01648
  6. 2548380Protein Holo-(acyl carrier protein) synthase ACPS [64419] (2 species)
  7. 2548381Species Bacillus subtilis [TaxId:1423] [64420] (3 PDB entries)
  8. 2548389Domain d1f80a_: 1f80 A: [59683]
    Other proteins in same PDB: d1f80d1, d1f80d2, d1f80e_, d1f80f_
    complexed with holo-ACP
    complexed with na

Details for d1f80a_

PDB Entry: 1f80 (more details), 2.3 Å

PDB Description: holo-(acyl carrier protein) synthase in complex with holo-(acyl carrier protein)
PDB Compounds: (A:) holo-(acyl carrier protein) synthase

SCOPe Domain Sequences for d1f80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f80a_ d.150.1.2 (A:) Holo-(acyl carrier protein) synthase ACPS {Bacillus subtilis [TaxId: 1423]}
aygiglditelkriasmagrqkrfaeriltrseldqyyelsearkneflagrfaakeafs
kafgtgigrqlsfqdieirkdqngkpyiictklsqaavhvsithtkeyaaaqvvierl

SCOPe Domain Coordinates for d1f80a_:

Click to download the PDB-style file with coordinates for d1f80a_.
(The format of our PDB-style files is described here.)

Timeline for d1f80a_: