Lineage for d1f7za_ (1f7z A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2057319Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)
  8. 2057324Domain d1f7za_: 1f7z A: [59681]
    Other proteins in same PDB: d1f7zi_
    complexed with ca, so4

Details for d1f7za_

PDB Entry: 1f7z (more details), 1.55 Å

PDB Description: rat trypsinogen k15a complexed with bovine pancreatic trypsin inhibitor
PDB Compounds: (A:) trypsin II, anionic

SCOPe Domain Sequences for d1f7za_:

Sequence, based on SEQRES records: (download)

>d1f7za_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records): (download)

>d1f7za_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngelqgi
vswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1f7za_:

Click to download the PDB-style file with coordinates for d1f7za_.
(The format of our PDB-style files is described here.)

Timeline for d1f7za_: