Lineage for d1f7xa_ (1f7x A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.129: TBP-like [55944] (4 superfamilies) Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) 
Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein) Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species) Species Escherichia coli [TaxId:562] [64386] (4 PDB entries) 
Domain d1f7xa_: 1f7x A: [59680]
Details for d1f7xa_
PDB Entry: 1f7x (more details)
PDB Description: solution structure of c-terminal domain zipa
SCOP Domain Sequences for d1f7xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7xa_ d.129.4.1 (A:) Cell-division protein ZipA, C-terminal domain {Escherichia coli}
mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddq
rrmmtpqklreyqdiirevkdana
SCOP Domain Coordinates for d1f7xa_:
Click to download the PDB-style file with coordinates for d1f7xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f7xa_:
- d1f7xa_ is new in SCOP 1.57
- d1f7xa_ appears in SCOP 1.59
- d1f7xa_ appears in the current release, SCOPe 2.08
View in 3D