Lineage for d1f7wa_ (1f7w A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582712Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family) (S)
    contains a single copy of this fold
    automatically mapped to Pfam PF04354
  5. 2582713Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)
  6. 2582714Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)
  7. 2582715Species Escherichia coli [TaxId:562] [64386] (6 PDB entries)
  8. 2582724Domain d1f7wa_: 1f7w A: [59679]

Details for d1f7wa_

PDB Entry: 1f7w (more details)

PDB Description: solution structure of c-terminal domain zipa
PDB Compounds: (A:) cell division protein zipa

SCOPe Domain Sequences for d1f7wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7wa_ d.129.4.1 (A:) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddq
rrmmtpqklreyqdiirevkdana

SCOPe Domain Coordinates for d1f7wa_:

Click to download the PDB-style file with coordinates for d1f7wa_.
(The format of our PDB-style files is described here.)

Timeline for d1f7wa_: